PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004063m
Common NameCARUB_v10004063mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 991aa    MW: 110095 Da    PI: 5.9085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004063mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-183581148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Carubv10004063m 35 KGQWTPEEDEVLCKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 81
                     799****************************9.************986 PP

2Myb_DNA-binding58.51.5e-1887133148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd  ++ +v+++G + W+tI+++++ gR +kqc++rw+++l
  Carubv10004063m  87 KGPWSKEEDNTIIALVERYGAKKWSTISQHLP-GRIGKQCRERWHNHL 133
                      79******************************.*************97 PP

3Myb_DNA-binding53.65e-17139181145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE++ l++a++ +G++ W+  ++ ++ gR+++++k++w+
  Carubv10004063m 139 KNAWTQEEELTLIRAHQIYGNK-WAELMKLLP-GRSDNSIKNHWN 181
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5233081IPR017930Myb domain
SuperFamilySSF466898.61E-183495IPR009057Homeodomain-like
SMARTSM007171.3E-143483IPR001005SANT/Myb domain
PfamPF002495.4E-153581IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-233798IPR009057Homeodomain-like
CDDcd001671.82E-133881No hitNo description
PROSITE profilePS5129431.36382137IPR017930Myb domain
SuperFamilySSF466893.74E-3084180IPR009057Homeodomain-like
SMARTSM007171.9E-1786135IPR001005SANT/Myb domain
PfamPF002493.4E-1787133IPR001005SANT/Myb domain
CDDcd001672.10E-1589133No hitNo description
Gene3DG3DSA:1.10.10.609.8E-2699141IPR009057Homeodomain-like
PROSITE profilePS5129418.453138188IPR017930Myb domain
SMARTSM007177.0E-15138186IPR001005SANT/Myb domain
PfamPF002498.9E-15139182IPR001005SANT/Myb domain
CDDcd001674.13E-11141181No hitNo description
Gene3DG3DSA:1.10.10.602.3E-20142188IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 991 aa     Download sequence    Send to blast
MKREMKAPII PPEGFQSELK GKHGRTSGPA RRSTKGQWTP EEDEVLCKAV ERFQGKNWKK  60
IAECFKDRTD VQCLHRWQKV LNPELVKGPW SKEEDNTIIA LVERYGAKKW STISQHLPGR  120
IGKQCRERWH NHLNPLINKN AWTQEEELTL IRAHQIYGNK WAELMKLLPG RSDNSIKNHW  180
NSSVKKKLDS YYASGLLDQC QSSPLIALQN KSIASSSSWM YSSGDEGNSR AGVDAEESEC  240
SQASTVFSQS TNDLQEEVKP GNEEFYMPEF HSRAEHQISN DAEPYYPSFE EVKIVVPEIS  300
CEAECSKKFQ NLTCSHEVRT TTATEDQLQG MSNEAKQDPD LDLLTDNMDN DGKNQAHRQA  360
FQSSGRLSEQ PSLPNSDTDP EAQTLITDEE CCRVLFPDTM KDSCTSSIKQ GRNMIDPRKG  420
KGCLCSQSVE SHAHETGKLP ALSRHPSSSE VQAGHNCVPL SDSDLKDPVL LRNDSNPPIQ  480
GSHLFGATEL ECKTVTNDSF IDTDGHVTSH GNDNDGIEQH GLSYIPKDSL KLVPLNSFSS  540
PSRVNRIYFP IDDKPAEKDK GALCYEPPRF PSADIPFFSC DLVPSNSDLR QEYSPFGIRQ  600
LMISSMNCTT PLRLWDSPCH ERSPDVMLND ATKSLSNAPS ILKKRHRDLL SPVLDRRKDK  660
KLKRAATSSL AKDLSCLDVM LDGGDDCMST RPSESPENKN RHASPSKAKD NRYSASGWSD  720
QEMIPIDEEP KETLKLGGVT SMQNQKGCNE GGASAKNDQE TSGTFVEIQL CSPGMTGGRS  780
DNKVNTSAKD LSNQHKRSLA DIPTEEISPE LPCTVDSSPL SAIDKTNTTE TSFDIENFNI  840
FDGTPYRKLL DTPSPWKSPL LFGSFLQSPK LPPEVTFEDI GCFMSPGERS YDAIGLMKHL  900
SEHSATAYAD ALEVLGNDTP ETILKKRQLN KSIQGKENQH HPHDQLGNRS QVERRTLDFS  960
DCGTPGKSTV SSAPPGGYSS PSSYLLKSCR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-65351886159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-65351886159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1654661DRRKDKKL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1516460.0AF151646.1 Arabidopsis thaliana PC-MYB1 (PC-MYB1) mRNA, complete cds.
GenBankAF1760050.0AF176005.2 Arabidopsis thaliana putative c-myb-like transcription factor (AtMYB3R-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283062.10.0hypothetical protein CARUB_v10004063mg
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLR0GUI60.0R0GUI6_9BRAS; Uncharacterized protein
STRINGAT4G32730.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein